PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G089406_P01
Common NameLOC100279451, ZEAMMB73_669752
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB_related
Protein Properties Length: 1533aa    MW: 165682 Da    PI: 6.0654
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G089406_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.77.5e-10669711347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE +++ ++ +++G++ +++Ia+ +  +++  +c+++++k+
  GRMZM2G089406_P01 669 PWTQEEKKIFMELLAKFGKD-FSKIASFIT-HKSTADCVEFYYKH 711
                        8*****************99.********9.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-14653714IPR009057Homeodomain-like
PROSITE profilePS5129315.771665716IPR017884SANT domain
SMARTSM007174.5E-10666714IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-7667713IPR009057Homeodomain-like
PfamPF002491.9E-8668711IPR001005SANT/Myb domain
PROSITE profilePS5129312.6875926IPR017884SANT domain
SMARTSM007174.5E-6876924IPR001005SANT/Myb domain
SuperFamilySSF466899.36E-9879926IPR009057Homeodomain-like
CDDcd001671.69E-4880918No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 1533 aa     Download sequence    Send to blast
MRGSYRRSPY RGGYGSDFSR NHPEQPPPPP PRRSPLRSVA VPICYDSPGN RVDRGDRDNL  60
PRVTPWRRRE SRSEPADAVG LLSVGQTTRL SASGKEASAQ PLSVSGPHGT EDEAPRKKAR  120
LGWGQGLAKY EKQKVQGPVD PAEAVADGSP ADGELKTTSP VPVPVHPVPV PVPYVAPAPP  180
AAPVLAPAPA PSAAPALLSA PMQCSSPVTG PPYCSSAPED KSCEMMPNAV TNSTKDVLEA  240
DDTTFNNEFL IKLDQLGDDP VISLGNMLVE LIQHEDSCSG DSNGPTSTYK LLLLKESISK  300
EIEKTELEID SLEGELKSVN TEAATTLEGS PTGVTHTENL SPSSGTSKVP GSVEICDTSD  360
MIKEPGELIG SPKVPVVQYD DVKSADMMEI ETAPVHNAKT VPSEAGAISP VVAEGKACAA  420
ADLSSLKASE EAGSQNDIDN GRLETSSRQA NADSMKIEIS DDLPVKKWTY HDHKSDLLSS  480
VTSANSAIAK EINEVLFKSL PADTPRLDLF ASSHLLSQRK SDLIVKERLG VCKTRLRLKE  540
QMLTMKFKAY CHLWKDVQLF SANKQRSKSN KRTDQSNRTS QIGSQRQRSS NRSRLTMPAG  600
NLSTFSTPEM SDVAMRLFSE FKIKRCRNYL KMPALIIDEK EKEWLKLMNK NGLVEDPVLV  660
EKERVMINPW TQEEKKIFME LLAKFGKDFS KIASFITHKS TADCVEFYYK HHKSDSFREV  720
KKLLDLRQQQ PTSNFLGAKS GHKWNPESNA ASLDMLGVAS VVAAHGLEYA KQVEKISAKS  780
LIRTAYGPNV TSVANKSSDK ECIDHVPLHE RESVAADVLA GICGTLSPDG MGSCITSSAD  840
PGQKISMKRV EHVLSQENDK TVEEEDTLSD QECEVDPVDW NDDEKSIFIE AMNNYGKDFA  900
RISSCVKSKS YEQCKVFFSK ARKSLGLDLI HQGAADVSMP ASDTNGGKSD TDEACAVEMD  960
SAICSTQSCS KIAMDVCPTE GAIGGPNSVI ISKQAEAYIS NGCNADVKIE EDEKVADKNC  1020
SIVDAKRSSD ATHEAGPIDI NCPGSTDKLQ GTDDVVDLVN MHSNSGISSS AKHAVAIHSE  1080
MRSTLHSVEV LQTDKGEGTG TDLSWVEECS HHALDNTPMK NGNSGAPAFL ASDSGIKDNV  1140
RISNITAAST VSPAFTSSYQ HSVPGDMPLP KPKPLVTPLT PKDLMPVQFS SVLPDPTAIR  1200
FEGIASITTP NFEDTGNRVS GALGAKEMSK YPAFRDPSGN QQSTLFCNID GYMNHRLTTE  1260
LPFFSERTAS GTVNTSQADR LTQTKLQNGR SSSLCLQNNS DGIQWPRDHE GGLEGSLRPC  1320
SRNTSSEGDE QQKRPGDVKL FGQILSHQST LQSSGLSCNG NKSKPPSPKI DTSVRSMNNP  1380
MDRVVCSSRP GTTPHLGLEE RLARCYGHLD GSTAQPEPLL VMAKRQRSLA GVQFYSAKNG  1440
TLGVLPDYQQ PSTQPQQSDP KRVERLSDPQ KRNVLELISG FQQPGRVARF GGAGILVSGN  1500
VSDPVAAALK AQYGPGSKIM GSDVDPWTDI GSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-14627718494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-14627718494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1394590.0cell lignification| ear| endosperm| meristem| ovary| pericarp| pollen| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G089406
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G089406_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9431480.0EU943148.1 Zea mays clone 1570595 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008654804.10.0PREDICTED: uncharacterized protein LOC100279451 isoform X2
RefseqXP_008654803.10.0PREDICTED: uncharacterized protein LOC100279451 isoform X1
RefseqXP_008654802.10.0PREDICTED: uncharacterized protein LOC100279451 isoform X1
TrEMBLK7UY070.0K7UY07_MAIZE; Putative MYB DNA-binding domain superfamily protein
STRINGGRMZM2G089406_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Representative plantOGRP32151725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-81MYB family protein